PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629672.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 303aa    MW: 34272.2 Da    PI: 9.175
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629672.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-163683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l  ++k +G g+W++ ++  g+ R++k+c++rw +yl
   XP_013629672.1 36 KGAWTKEEDARLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 83
                     79******************************99************97 PP

2Myb_DNA-binding582.2e-1889133147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Edel+++++ +lG++ W++Ia +++ gRt++++k++w+++
   XP_013629672.1  89 RGNFTEDEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 133
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-232786IPR009057Homeodomain-like
PROSITE profilePS5129415.3543183IPR017930Myb domain
SuperFamilySSF466894.87E-2935130IPR009057Homeodomain-like
SMARTSM007171.1E-123585IPR001005SANT/Myb domain
PfamPF002491.0E-133683IPR001005SANT/Myb domain
CDDcd001675.13E-93883No hitNo description
PROSITE profilePS5129428.82184138IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2787139IPR009057Homeodomain-like
SMARTSM007172.5E-1788136IPR001005SANT/Myb domain
PfamPF002491.3E-1689133IPR001005SANT/Myb domain
CDDcd001677.21E-1291134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MYVRFSYQEI IRSKHRKQKE KSMGRSPCCE KAHTNKGAWT KEEDARLTAY IKAHGEGCWR  60
SLPKAAGLLR CGKSCRLRWI NYLRPDLKRG NFTEDEDELI IKLHSLLGNK WSLIAGRLPG  120
RTDNEIKNYW NTHIRRKLIN RGIDPTTHRP VQESSSASQD SKPTQLAEAI TSNNTINISF  180
TNTPKMESTS CFQVKPEKIS MLTFKEEKDE FLIEEKLPDL NLELRISLPD VVEGKSTRER  240
CFKCSLGMIN GMECRCGSMR CDVVGGSSGS TGKGGDISHG FDFLGLATKE TTSLLGFRSL  300
EMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-293513826128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0765490.0KR076549.1 Brassica napus MYB transcription factor 4-1 (MYB4-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629672.10.0PREDICTED: transcription repressor MYB4
SwissprotQ9SZP11e-170MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A0D3BJ890.0A0A0D3BJ89_BRAOL; Uncharacterized protein
STRINGBra010736.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-157myb domain protein 4